PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A02G1369
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 306aa    MW: 34544.2 Da    PI: 6.7936
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A02G1369genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.3e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv+ +++ G g+W++ ++  g++R++k+c++rw +yl
      Gh_A02G1369 15 KGPWTPEEDQKLVKFIHENGHGSWRALPKLAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding54.52.6e-1768113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++l
      Gh_A02G1369  68 RGKFSHEEEQTILNLHSILGNK-WSAIASHLP-GRTDNEIKNFWNTHL 113
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.1521062IPR017930Myb domain
SuperFamilySSF466895.62E-3112109IPR009057Homeodomain-like
SMARTSM007174.7E-151464IPR001005SANT/Myb domain
PfamPF002492.5E-171562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-231669IPR009057Homeodomain-like
CDDcd001671.59E-111762No hitNo description
PROSITE profilePS5129426.4463117IPR017930Myb domain
SMARTSM007171.8E-1667115IPR001005SANT/Myb domain
PfamPF002493.6E-1668113IPR001005SANT/Myb domain
CDDcd001678.18E-1270113No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2770118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MGRSPCCDEN TGLKKGPWTP EEDQKLVKFI HENGHGSWRA LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGK FSHEEEQTIL NLHSILGNKW SAIASHLPGR TDNEIKNFWN THLKKKLIQM  120
GIDPMTHRPR TDMFSSLPYL IALANLKELM DQPWEEQALR LKAEAVQMAN LQSLQYLLQL  180
TSVPTSSTST IINTFTDMDA INTLLNPVSI NKDSSTNIAT AAAASLQGFN DSIPFPRLPD  240
LHQVPSTKTD VEKLDNSSMV PNVAETLTHN LGDIACSYKE ADHLSVWPHH DDHHLIFEDP  300
LFHELS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28131175108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012472593.10.0PREDICTED: transcription factor MYB39
TrEMBLA0A0D2NVY90.0A0A0D2NVY9_G
STRINGVIT_07s0141g00100.t011e-126(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.13e-99myb domain protein 93